SCOP 1.75: Domain d1zfja4: 1zfj A:95-220

Lineage for d1zfja4 (1zfj A:95-220)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (1 family)

5. Family d.37.1.1: CBS-domain pair [54632] (20 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
   contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals

7. Species Streptococcus pyogenes [TaxId:1314] [54635] (1 PDB entry)

8. Domain d1zfja4: 1zfj A:95-220 [144739]
   Other proteins in same PDB: d1zfja1
   complexed with imp

Details for d1zfja4

PDB Entry: 1zfj, 1.9 Å

PDB Description: inosine monophosphate dehydrogenase (impdh; ec 1.1.1.205) from streptococcus pyogenes

PDB Compounds: (A:) inosine monophosphate dehydrogenase

SCOP Domain Sequences for d1zfja4:

Sequence; same for both SEQRES and ATOM records:

>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]}
ngviidpffltpehkvseaeelmqryrisgvpivetlanrklvgiitnrdmrfisdynap
isehmtsehlvtaavgtdletaerilhehrieklplvdnsgrlsglitikdiekviefph
aakdef

Timeline for d1zfja4:

• d1zfja4 is new in SCOP 1.75
  
• d1zfja4 appears in SCOPe 2.01
  
• d1zfja4 appears in the current release, SCOPe 2.08