Lineage for d1zfja4 (1zfj A:95-220)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943255Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2943353Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
    contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals
  7. 2943365Species Streptococcus pyogenes [TaxId:1314] [54635] (1 PDB entry)
  8. 2943366Domain d1zfja4: 1zfj A:95-220 [144739]
    Other proteins in same PDB: d1zfja1
    complexed with imp

Details for d1zfja4

PDB Entry: 1zfj (more details), 1.9 Å

PDB Description: inosine monophosphate dehydrogenase (impdh; ec 1.1.1.205) from streptococcus pyogenes
PDB Compounds: (A:) inosine monophosphate dehydrogenase

SCOPe Domain Sequences for d1zfja4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]}
ngviidpffltpehkvseaeelmqryrisgvpivetlanrklvgiitnrdmrfisdynap
isehmtsehlvtaavgtdletaerilhehrieklplvdnsgrlsglitikdiekviefph
aakdef

SCOPe Domain Coordinates for d1zfja4:

Click to download the PDB-style file with coordinates for d1zfja4.
(The format of our PDB-style files is described here.)

Timeline for d1zfja4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zfja1