Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Human (Homo sapiens), delta-chain [TaxId:9606] [48938] (3 PDB entries) |
Domain d1ypze1: 1ypz E:1-119 [144708] Other proteins in same PDB: d1ypza1, d1ypza2, d1ypzb1, d1ypzc1, d1ypzc2, d1ypzd1, d1ypze2, d1ypzf2, d1ypzg2, d1ypzh2 |
PDB Entry: 1ypz (more details), 3.4 Å
SCOPe Domain Sequences for d1ypze1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ypze1 b.1.1.1 (E:1-119) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk safdskerrystlhirdaqledsgtyfcaadtwhisegyelgtdklvfgqgtqvtvepk
Timeline for d1ypze1: