Lineage for d1ymmd1 (1ymm D:9-104)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783727Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 783728Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (17 PDB entries)
  8. 783748Domain d1ymmd1: 1ymm D:9-104 [144702]
    Other proteins in same PDB: d1ymma1, d1ymma2, d1ymmb1, d1ymmb2, d1ymme2
    complexed with nag; mutant

Details for d1ymmd1

PDB Entry: 1ymm (more details), 3.5 Å

PDB Description: TCR/HLA-DR2b/MBP-peptide complex
PDB Compounds: (D:) T cell receptor alpha chain

SCOP Domain Sequences for d1ymmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
qalsiqegenatmncsyktsinnlqwyrqnsgrglvhlilirsnerekhsgrlrvtldts
kksssllitasraadtasyfcatdttsgtykyifgt

SCOP Domain Coordinates for d1ymmd1:

Click to download the PDB-style file with coordinates for d1ymmd1.
(The format of our PDB-style files is described here.)

Timeline for d1ymmd1: