Lineage for d1yl381 (1yl3 8:2-64)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2242290Fold d.301: L35p-like [143033] (1 superfamily)
    core: alpha-beta(3)-alpha; 2layers a/b
  4. 2242291Superfamily d.301.1: L35p-like [143034] (1 family) (S)
    automatically mapped to Pfam PF01632
  5. 2242292Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
    Pfam PF01632
  6. 2242293Protein Ribosomal protein L35p [143036] (3 species)
  7. 2242329Species Thermus thermophilus [TaxId:274] [160057] (9 PDB entries)
    Uniprot P80341 1-64
  8. 2242335Domain d1yl381: 1yl3 8:2-64 [144695]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl381

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (8:) 50S ribosomal protein L35

SCOPe Domain Sequences for d1yl381:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl381 d.301.1.1 (8:2-64) Ribosomal protein L35p {Thermus thermophilus [TaxId: 274]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

SCOPe Domain Coordinates for d1yl381:

Click to download the PDB-style file with coordinates for d1yl381.
(The format of our PDB-style files is described here.)

Timeline for d1yl381: