Lineage for d1yl351 (1yl3 5:2-59)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464553Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1464705Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 1464706Protein Ribosomal protein L32p [144201] (3 species)
  7. 1464742Species Thermus thermophilus [TaxId:274] [161177] (11 PDB entries)
    Uniprot P80339 1-59
  8. 1464750Domain d1yl351: 1yl3 5:2-59 [144693]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1
    automatically matched to 2ZJR Z:2-59

Details for d1yl351

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (5:) 50S ribosomal protein L32

SCOPe Domain Sequences for d1yl351:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl351 g.41.8.5 (5:2-59) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOPe Domain Coordinates for d1yl351:

Click to download the PDB-style file with coordinates for d1yl351.
(The format of our PDB-style files is described here.)

Timeline for d1yl351: