Class b: All beta proteins [48724] (174 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.4: Ribosomal L27 protein-like [110324] (2 families) rudiment single hybrid fold with a permuted topology |
Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein) Pfam PF01016 |
Protein Ribosomal protein L27 [110326] (3 species) |
Species Thermus thermophilus [TaxId:274] [110327] (6 PDB entries) Uniprot P84123 |
Domain d1yl331: 1yl3 3:2-85 [144692] Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1 automatically matched to 2ZJR T:2-85 |
PDB Entry: 1yl3 (more details), 5.5 Å
SCOPe Domain Sequences for d1yl331:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yl331 b.84.4.1 (3:2-85) Ribosomal protein L27 {Thermus thermophilus [TaxId: 274]} ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa lsdgkvvfinkgkgarfisieaaq
Timeline for d1yl331:
View in 3D Domains from other chains: (mouse over for more information) d1yl301, d1yl311, d1yl321, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1 |