Lineage for d1yl311 (1yl3 1:2-118)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284194Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 1284219Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
    automatically mapped to Pfam PF00453
  5. 1284220Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 1284221Protein Ribosomal protein L20 [74733] (4 species)
  7. 1284261Species Thermus thermophilus [TaxId:274] [158510] (15 PDB entries)
    Uniprot P60491 1-117
  8. 1284273Domain d1yl311: 1yl3 1:2-118 [144690]
    Other proteins in same PDB: d1yl301, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1
    automatically matched to 2ZJR N:2-118

Details for d1yl311

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (1:) 50S ribosomal protein L20

SCOPe Domain Sequences for d1yl311:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl311 a.144.2.1 (1:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]}
praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq

SCOPe Domain Coordinates for d1yl311:

Click to download the PDB-style file with coordinates for d1yl311.
(The format of our PDB-style files is described here.)

Timeline for d1yl311: