Lineage for d1yjn21 (1yjn 2:1-49)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016286Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2016287Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
    automatically mapped to Pfam PF00832
  5. 2016288Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 2016289Protein Ribosomal protein L39e [48664] (1 species)
  7. 2016290Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 2016317Domain d1yjn21: 1yjn 2:1-49 [144650]
    Other proteins in same PDB: d1yjn11, d1yjn31, d1yjna1, d1yjna2, d1yjnb1, d1yjnc1, d1yjnd1, d1yjne1, d1yjne2, d1yjnf1, d1yjng1, d1yjnh1, d1yjni1, d1yjnj1, d1yjnk1, d1yjnl1, d1yjnm1, d1yjnn1, d1yjno1, d1yjnp1, d1yjnq1, d1yjnr1, d1yjns1, d1yjnt1, d1yjnu1, d1yjnv1, d1yjnw1, d1yjnx1, d1yjny1, d1yjnz1
    automatically matched to 1VQ4 2:1-49
    complexed with cd, cl, cly, k, mg, na; mutant

Details for d1yjn21

PDB Entry: 1yjn (more details), 3 Å

PDB Description: crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d1yjn21:

Sequence, based on SEQRES records: (download)

>d1yjn21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1yjn21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOPe Domain Coordinates for d1yjn21:

Click to download the PDB-style file with coordinates for d1yjn21.
(The format of our PDB-style files is described here.)

Timeline for d1yjn21: