Lineage for d1yihb1 (1yih B:1-146)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 902583Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 902696Species Human (Homo sapiens) [TaxId:9606] [46501] (196 PDB entries)
    Uniprot P68871
  8. 902889Domain d1yihb1: 1yih B:1-146 [144640]
    Other proteins in same PDB: d1yiha_, d1yihc_
    complexed with hem, oxy

Details for d1yihb1

PDB Entry: 1yih (more details), 2 Å

PDB Description: t-to-t(high) quaternary transitions in human hemoglobin: betap100a oxy (2.2mm ihp, 20% peg) (1 test set)
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1yihb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yihb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdaenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d1yihb1:

Click to download the PDB-style file with coordinates for d1yihb1.
(The format of our PDB-style files is described here.)

Timeline for d1yihb1: