SCOP 1.75: Domain d1ydpa2: 1ydp A:2-181

Lineage for d1ydpa2 (1ydp A:2-181)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-G [TaxId:9606] [160076] (3 PDB entries)
   Uniprot P17693 25-205! Uniprot P17693 26-205

8. Domain d1ydpa2: 1ydp A:2-181 [144634]
   Other proteins in same PDB: d1ydpa1, d1ydpb1
   complexed with cl, co; mutant

Details for d1ydpa2

PDB Entry: 1ydp, 1.9 Å

PDB Description: 1.9a crystal structure of hla-g

PDB Compounds: (A:) MHC class I antigen

SCOP Domain Sequences for d1ydpa2:

Sequence; same for both SEQRES and ATOM records:

>d1ydpa2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-G [TaxId: 9606]}
shsmryfsaavsrpgrgeprfiamgyvddtqfvrfdsdsasprmeprapwveqegpeywe
eetrntkahaqtdrmnlqtlrgyynqseasshtlqwmigcdlgsdgrlirgyeryaydgk
dylalnedlrswtaadtaaqiskrkceaanvaeqrraylegtcvewlhrylengkemlqr

Timeline for d1ydpa2:

• d1ydpa2 is new in SCOP 1.75
  
• d1ydpa2 appears in SCOPe 2.01
  
• d1ydpa2 appears in the current release, SCOPe 2.08