SCOPe 2.04: Domain d1yd8h_: 1yd8 H:

Lineage for d1yd8h_ (1yd8 H:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.8: GAT-like domain [89009] (3 families)

5. Family a.7.8.1: GAT domain [89010] (3 proteins)
   this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain

6. Protein ADP-ribosylation factor binding protein Gga3 [158363] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158364] (2 PDB entries)
   Uniprot Q9NZ52 208-299! Uniprot Q9NZ52 211-300

8. Domain d1yd8h_: 1yd8 H: [144632]
   Other proteins in same PDB: d1yd8u_, d1yd8v_
   automated match to d1yd8g1

Details for d1yd8h_

PDB Entry: 1yd8, 2.8 Å

PDB Description: complex of human gga3 gat domain and ubiquitin

PDB Compounds: (H:) ADP-ribosylation factor binding protein gga3

SCOPe Domain Sequences for d1yd8h_:

Sequence; same for both SEQRES and ATOM records:

>d1yd8h_ a.7.8.1 (H:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
giqkvtkrlhtleevnnnvrllsemllhysqedssdgdrelmkelfdqcenkrrtlfkla
setedndnslgdilqasdnlsrvinsyktiieg

Timeline for d1yd8h_:

• d1yd8h_ first appeared in SCOP 1.75, called d1yd8h1
  
• d1yd8h_ appears in SCOPe 2.03
  
• d1yd8h_ appears in SCOPe 2.05
  
• d1yd8h_ appears in the current release, SCOPe 2.08, called d1yd8h2