Lineage for d1yd8h_ (1yd8 H:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1081581Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1081818Superfamily a.7.8: GAT-like domain [89009] (2 families) (S)
  5. 1081819Family a.7.8.1: GAT domain [89010] (3 proteins)
  6. 1081828Protein ADP-ribosylation factor binding protein Gga3 [158363] (1 species)
  7. 1081829Species Human (Homo sapiens) [TaxId:9606] [158364] (2 PDB entries)
    Uniprot Q9NZ52 208-299! Uniprot Q9NZ52 211-300
  8. 1081835Domain d1yd8h_: 1yd8 H: [144632]
    Other proteins in same PDB: d1yd8u_, d1yd8v_
    automated match to d1yd8g1

Details for d1yd8h_

PDB Entry: 1yd8 (more details), 2.8 Å

PDB Description: complex of human gga3 gat domain and ubiquitin
PDB Compounds: (H:) ADP-ribosylation factor binding protein gga3

SCOPe Domain Sequences for d1yd8h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yd8h_ a.7.8.1 (H:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
giqkvtkrlhtleevnnnvrllsemllhysqedssdgdrelmkelfdqcenkrrtlfkla
setedndnslgdilqasdnlsrvinsyktiieg

SCOPe Domain Coordinates for d1yd8h_:

Click to download the PDB-style file with coordinates for d1yd8h_.
(The format of our PDB-style files is described here.)

Timeline for d1yd8h_: