Class a: All alpha proteins [46456] (284 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.8: GAT-like domain [89009] (2 families) |
Family a.7.8.1: GAT domain [89010] (3 proteins) this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain |
Protein ADP-ribosylation factor binding protein Gga3 [158363] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158364] (2 PDB entries) Uniprot Q9NZ52 208-299! Uniprot Q9NZ52 211-300 |
Domain d1yd8h_: 1yd8 H: [144632] Other proteins in same PDB: d1yd8u_, d1yd8v_ automated match to d1yd8g1 |
PDB Entry: 1yd8 (more details), 2.8 Å
SCOPe Domain Sequences for d1yd8h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yd8h_ a.7.8.1 (H:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} giqkvtkrlhtleevnnnvrllsemllhysqedssdgdrelmkelfdqcenkrrtlfkla setedndnslgdilqasdnlsrvinsyktiieg
Timeline for d1yd8h_: