Lineage for d1yd8h1 (1yd8 H:208-299)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763928Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764132Superfamily a.7.8: GAT-like domain [89009] (2 families) (S)
  5. 764133Family a.7.8.1: GAT domain [89010] (3 proteins)
    this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain
  6. 764142Protein ADP-ribosylation factor binding protein Gga3 [158363] (1 species)
  7. 764143Species Human (Homo sapiens) [TaxId:9606] [158364] (2 PDB entries)
    Uniprot Q9NZ52 208-299! Uniprot Q9NZ52 211-300
  8. 764149Domain d1yd8h1: 1yd8 H:208-299 [144632]
    Other proteins in same PDB: d1yd8u1, d1yd8v1
    automatically matched to 1YD8 G:208-299

Details for d1yd8h1

PDB Entry: 1yd8 (more details), 2.8 Å

PDB Description: complex of human gga3 gat domain and ubiquitin
PDB Compounds: (H:) ADP-ribosylation factor binding protein gga3

SCOP Domain Sequences for d1yd8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yd8h1 a.7.8.1 (H:208-299) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
iqkvtkrlhtleevnnnvrllsemllhysqedssdgdrelmkelfdqcenkrrtlfklas
etedndnslgdilqasdnlsrvinsyktiieg

SCOP Domain Coordinates for d1yd8h1:

Click to download the PDB-style file with coordinates for d1yd8h1.
(The format of our PDB-style files is described here.)

Timeline for d1yd8h1: