SCOP 1.75: Domain d1yava3: 1yav A:13-144

Lineage for d1yava3 (1yav A:13-144)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (1 family)

5. Family d.37.1.1: CBS-domain pair [54632] (20 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Hypothetical protein YkuL [117881] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [117882] (1 PDB entry)
   Uniprot O31698 9-142

8. Domain d1yava3: 1yav A:13-144 [144629]
   Structural genomics target

Details for d1yava3

PDB Entry: 1yav, 2.1 Å

PDB Description: crystal structure of cbs domain-containing protein ykul from bacillus subtilis

PDB Compounds: (A:) hypothetical protein BSU14130

SCOP Domain Sequences for d1yava3:

Sequence; same for both SEQRES and ATOM records:

>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]}
eatvgqfmieadkvahvqvgnnlehallvltktgytaipvldpsyrlhgligtnmimnsi
fgleriefekldqitveevmltdiprlhindpimkgfgmvinngfvcvendeqvfegift
rrvvlkelnkhi

Timeline for d1yava3:

• d1yava3 is new in SCOP 1.75
  
• d1yava3 appears in SCOPe 2.01
  
• d1yava3 appears in the current release, SCOPe 2.08