Lineage for d1yarr1 (1yar R:4-231)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765527Superfamily a.24.8: Proteasome activator [47216] (1 family) (S)
  5. 765528Family a.24.8.1: Proteasome activator [47217] (2 proteins)
  6. 765529Protein Proteasome activator protein PA26 [158392] (1 species)
  7. 765530Species Trypanosoma brucei [TaxId:5691] [158393] (3 PDB entries)
    Uniprot Q9U8G2 4-231
  8. 765534Domain d1yarr1: 1yar R:4-231 [144618]
    Other proteins in same PDB: d1yara1, d1yarb1, d1yarc1, d1yard1, d1yare1, d1yarf1, d1yarg1, d1yarh1, d1yari1, d1yarj1, d1yark1, d1yarl1, d1yarm1, d1yarn1
    automatically matched to 1YA7 O:4-231
    complexed with gol, so4; mutant

Details for d1yarr1

PDB Entry: 1yar (more details), 1.9 Å

PDB Description: Structure of Archeabacterial 20S proteasome mutant D9S- PA26 complex
PDB Compounds: (R:) proteasome activator protein PA26

SCOP Domain Sequences for d1yarr1:

Sequence, based on SEQRES records: (download)

>d1yarr1 a.24.8.1 (R:4-231) Proteasome activator protein PA26 {Trypanosoma brucei [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
rqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs

Sequence, based on observed residues (ATOM records): (download)

>d1yarr1 a.24.8.1 (R:4-231) Proteasome activator protein PA26 {Trypanosoma brucei [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
velatthlstmvravinayllnwkkliqprtgsdhmvs

SCOP Domain Coordinates for d1yarr1:

Click to download the PDB-style file with coordinates for d1yarr1.
(The format of our PDB-style files is described here.)

Timeline for d1yarr1: