Lineage for d1ya7u1 (1ya7 U:4-231)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765527Superfamily a.24.8: Proteasome activator [47216] (1 family) (S)
  5. 765528Family a.24.8.1: Proteasome activator [47217] (2 proteins)
  6. 765529Protein Proteasome activator protein PA26 [158392] (1 species)
  7. 765530Species Trypanosoma brucei [TaxId:5691] [158393] (3 PDB entries)
    Uniprot Q9U8G2 4-231
  8. 765544Domain d1ya7u1: 1ya7 U:4-231 [144614]
    Other proteins in same PDB: d1ya7a1, d1ya7b1, d1ya7c1, d1ya7d1, d1ya7e1, d1ya7f1, d1ya7g1, d1ya7h1, d1ya7i1, d1ya7j1, d1ya7k1, d1ya7l1, d1ya7m1, d1ya7n1
    automatically matched to 1YA7 O:4-231
    complexed with gol, so4

Details for d1ya7u1

PDB Entry: 1ya7 (more details), 2.3 Å

PDB Description: Implications for interactions of proteasome with PAN and PA700 from the 1.9 A structure of a proteasome-11S activator complex
PDB Compounds: (U:) proteasome activator protein PA26

SCOP Domain Sequences for d1ya7u1:

Sequence, based on SEQRES records: (download)

>d1ya7u1 a.24.8.1 (U:4-231) Proteasome activator protein PA26 {Trypanosoma brucei [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
rqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs

Sequence, based on observed residues (ATOM records): (download)

>d1ya7u1 a.24.8.1 (U:4-231) Proteasome activator protein PA26 {Trypanosoma brucei [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
velatthlstmvravinayllnwkkliqprtgsdhmvs

SCOP Domain Coordinates for d1ya7u1:

Click to download the PDB-style file with coordinates for d1ya7u1.
(The format of our PDB-style files is described here.)

Timeline for d1ya7u1: