SCOPe 2.06: Domain d1y8xb1: 1y8x B:349-440

Lineage for d1y8xb1 (1y8x B:349-440)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest

4. Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families)
   transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
   the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds

5. Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (3 proteins)
   the common fold is elaborated with additional (sub)domains

6. Protein UBA3 [89764] (1 species)
   a subunit of the heterodimeric E1 enzyme for NEDD8; contains an all-alpha insert subdomain of the FF-like fold (residues 210-288) and an extra C-terminal alpha+beta subdomain (partly disordered)

7. Species Human (Homo sapiens) [TaxId:9606] [89765] (12 PDB entries)
   Uniprot Q8TBC4 33-458

8. Domain d1y8xb1: 1y8x B:349-440 [144607]
   Other proteins in same PDB: d1y8xa1, d1y8xa2
   C-terminal, E2 binding domain only; (this domain belongs to Pfam PF08825)

Details for d1y8xb1

PDB Entry: 1y8x, 2.4 Å

PDB Description: structural basis for recruitment of ubc12 by an e2-binding domain in nedd8's e1

PDB Compounds: (B:) ubiquitin-activating enzyme E1C

SCOPe Domain Sequences for d1y8xb1:

Sequence; same for both SEQRES and ATOM records:

>d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]}
lpqniqfspsaklqevldyltnsaslqmkspaitatlegknrtlymqsvtsieertrpnl
sktlkelglvdgqelavadvttpqtvlfklhf

Timeline for d1y8xb1:

• d1y8xb1 first appeared in SCOP 1.75
  
• d1y8xb1 appears in SCOPe 2.05
  
• d1y8xb1 appears in SCOPe 2.07
  
• d1y8xb1 appears in the current release, SCOPe 2.08