Lineage for d1y4zb1 (1y4z B:1-509)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650134Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1650266Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1650393Protein Respiratory nitrate reductase 1 beta chain [102955] (2 species)
  7. 1650398Species Escherichia coli [TaxId:562] [102956] (8 PDB entries)
    Uniprot P11349
  8. 1650402Domain d1y4zb1: 1y4z B:1-509 [144594]
    Other proteins in same PDB: d1y4za1, d1y4za2, d1y4zc_
    complexed with 6mo, aga, f3s, hem, md1, pci, sf4

Details for d1y4zb1

PDB Entry: 1y4z (more details), 2 Å

PDB Description: the crystal structure of nitrate reductase a, narghi, in complex with the q-site inhibitor pentachlorophenol
PDB Compounds: (B:) Respiratory nitrate reductase 1 beta chain

SCOPe Domain Sequences for d1y4zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y4zb1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}
mkirsqvgmvlnldkcigchtcsvtaknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
gdgchgsdtkfnlfnsrridaidvtskte

SCOPe Domain Coordinates for d1y4zb1:

Click to download the PDB-style file with coordinates for d1y4zb1.
(The format of our PDB-style files is described here.)

Timeline for d1y4zb1: