Lineage for d1xwde_ (1xwd E:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638602Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)
  6. 2638603Protein Follicle stimulating hormone, follitropin, beta chain [64562] (1 species)
  7. 2638604Species Human (Homo sapiens) [TaxId:9606] [64563] (3 PDB entries)
  8. 2638606Domain d1xwde_: 1xwd E: [144582]
    Other proteins in same PDB: d1xwda_, d1xwdc1, d1xwdd_, d1xwdf_
    automated match to d1fl7b_
    complexed with nag, so4

Details for d1xwde_

PDB Entry: 1xwd (more details), 2.92 Å

PDB Description: crystal structure of human follicle stimulating hormone complexed with its receptor
PDB Compounds: (E:) Follitropin beta chain

SCOPe Domain Sequences for d1xwde_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwde_ g.17.1.4 (E:) Follicle stimulating hormone, follitropin, beta chain {Human (Homo sapiens) [TaxId: 9606]}
celtnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyetvr
vpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfg

SCOPe Domain Coordinates for d1xwde_:

Click to download the PDB-style file with coordinates for d1xwde_.
(The format of our PDB-style files is described here.)

Timeline for d1xwde_: