Lineage for d1xwdb1 (1xwd B:3-107)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891138Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 891139Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 891311Family g.17.1.4: Gonadodropin/Follitropin [57528] (3 proteins)
  6. 891312Protein Follicle stimulating hormone, follitropin, beta chain [64562] (1 species)
  7. 891313Species Human (Homo sapiens) [TaxId:9606] [64563] (2 PDB entries)
  8. 891314Domain d1xwdb1: 1xwd B:3-107 [144580]
    Other proteins in same PDB: d1xwda1, d1xwdc1, d1xwdd1
    complexed with bma, nag, so4

Details for d1xwdb1

PDB Entry: 1xwd (more details), 2.92 Å

PDB Description: crystal structure of human follicle stimulating hormone complexed with its receptor
PDB Compounds: (B:) Follitropin beta chain

SCOP Domain Sequences for d1xwdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwdb1 g.17.1.4 (B:3-107) Follicle stimulating hormone, follitropin, beta chain {Human (Homo sapiens) [TaxId: 9606]}
celtnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyetvr
vpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfg

SCOP Domain Coordinates for d1xwdb1:

Click to download the PDB-style file with coordinates for d1xwdb1.
(The format of our PDB-style files is described here.)

Timeline for d1xwdb1: