Lineage for d1wcbb2 (1wcb B:114-211)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 933318Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 933627Species Mouse (Mus musculus) [TaxId:10090] [88576] (373 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 933902Domain d1wcbb2: 1wcb B:114-211 [144555]
    Other proteins in same PDB: d1wcba1, d1wcba2, d1wcbb1, d1wcbh1, d1wcbl1, d1wcbl2
    automatically matched to 1WC7 B:114-211
    complexed with iod, pe1

Details for d1wcbb2

PDB Entry: 1wcb (more details), 2.5 Å

PDB Description: plp-dependent catalytic antibody 15a9 in complex with its hapten
PDB Compounds: (B:) fab fragment of catalytic antibody 15a9, heavy chain

SCOPe Domain Sequences for d1wcbb2:

Sequence, based on SEQRES records: (download)

>d1wcbb2 b.1.1.2 (B:114-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkiv

Sequence, based on observed residues (ATOM records): (download)

>d1wcbb2 b.1.1.2 (B:114-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
tlsssvtvpssprpsetvtcnvahpasstkvdkkiv

SCOPe Domain Coordinates for d1wcbb2:

Click to download the PDB-style file with coordinates for d1wcbb2.
(The format of our PDB-style files is described here.)

Timeline for d1wcbb2: