Class b: All beta proteins [48724] (174 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (4 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.1: PNP-oxidase like [50476] (16 proteins) |
Protein NimA-related protein DR0842 [117228] (1 species) |
Species Deinococcus radiodurans [TaxId:1299] [117229] (5 PDB entries) Uniprot Q9RW27 |
Domain d1w3oa1: 1w3o A:2-195 [144544] complexed with act, pyr |
PDB Entry: 1w3o (more details), 1.6 Å
SCOP Domain Sequences for d1w3oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w3oa1 b.45.1.1 (A:2-195) NimA-related protein DR0842 {Deinococcus radiodurans [TaxId: 1299]} sdfydprerdpsvsrrpqnrqsdewirelllrgtiarvatlwqgedgaafpfitplayay rpeqgdlvyhtnvvgrlranagqghpatlevseigqflpsnsplelsvqyrsvmvfgtar vlagedaraalttlservfpglkvgettrpiseddlkrtsvyslsidrwsgkenwaeqai qeedwpalgpewlg
Timeline for d1w3oa1: