Lineage for d1w3oa1 (1w3o A:2-195)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801826Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 801827Superfamily b.45.1: FMN-binding split barrel [50475] (4 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 801828Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)
  6. 801893Protein NimA-related protein DR0842 [117228] (1 species)
  7. 801894Species Deinococcus radiodurans [TaxId:1299] [117229] (5 PDB entries)
    Uniprot Q9RW27
  8. 801896Domain d1w3oa1: 1w3o A:2-195 [144544]
    complexed with act, pyr

Details for d1w3oa1

PDB Entry: 1w3o (more details), 1.6 Å

PDB Description: crystal structure of nima from d. radiodurans
PDB Compounds: (A:) nima-related protein

SCOP Domain Sequences for d1w3oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3oa1 b.45.1.1 (A:2-195) NimA-related protein DR0842 {Deinococcus radiodurans [TaxId: 1299]}
sdfydprerdpsvsrrpqnrqsdewirelllrgtiarvatlwqgedgaafpfitplayay
rpeqgdlvyhtnvvgrlranagqghpatlevseigqflpsnsplelsvqyrsvmvfgtar
vlagedaraalttlservfpglkvgettrpiseddlkrtsvyslsidrwsgkenwaeqai
qeedwpalgpewlg

SCOP Domain Coordinates for d1w3oa1:

Click to download the PDB-style file with coordinates for d1w3oa1.
(The format of our PDB-style files is described here.)

Timeline for d1w3oa1: