SCOPe 2.03: Domain d1vsax1: 1vsa X:1-60

Lineage for d1vsax1 (1vsa X:1-60)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
   short-chain member of the family

7. Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries)

8. Domain d1vsax1: 1vsa X:1-60 [144532]
   Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsaz1
   automatically matched to d1bxya_
   protein/RNA complex

Details for d1vsax1

PDB Entry: 1vsa, 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8

PDB Compounds: (X:) 50S ribosomal protein L30

SCOPe Domain Sequences for d1vsax1:

Sequence; same for both SEQRES and ATOM records:

>d1vsax1 d.59.1.1 (X:1-60) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]}
mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

Timeline for d1vsax1:

• d1vsax1 first appeared in SCOP 1.75
  
• d1vsax1 appears in SCOPe 2.02
  
• d1vsax1 appears in SCOPe 2.04
  
• d1vsax1 appears in the current release, SCOPe 2.08