Lineage for d1vsar1 (1vsa R:3-94)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536709Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2536710Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2536711Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 2536712Protein Ribosomal protein L23 [54191] (4 species)
  7. 2536810Species Thermus thermophilus [TaxId:274] [89815] (11 PDB entries)
  8. 2536817Domain d1vsar1: 1vsa R:3-94 [144529]
    Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
    protein/RNA complex
    protein/RNA complex

Details for d1vsar1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (R:) 50S ribosomal protein L23

SCOPe Domain Sequences for d1vsar1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsar1 d.12.1.1 (R:3-94) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]}
taydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvrgk
kkrlgrylgkrpdrkkaivqvapgqkiealeg

SCOPe Domain Coordinates for d1vsar1:

Click to download the PDB-style file with coordinates for d1vsar1.
(The format of our PDB-style files is described here.)

Timeline for d1vsar1: