Lineage for d1vsam1 (1vsa M:23-108)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 996570Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 996571Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 996572Protein Ribosomal protein L18 (L18p) [53139] (5 species)
  7. 996653Species Thermus thermophilus [TaxId:274] [75245] (7 PDB entries)
  8. 996660Domain d1vsam1: 1vsa M:23-108 [144525]
    Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
    automatically matched to d1ilya_
    protein/RNA complex

Details for d1vsam1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (M:) 50S ribosomal protein L18

SCOPe Domain Sequences for d1vsam1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsam1 c.55.4.1 (M:23-108) Ribosomal protein L18 (L18p) {Thermus thermophilus [TaxId: 274]}
rlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgnktevarqvgralaekalalgi
kqvafdrgpykyhgrvkalaegareg

SCOPe Domain Coordinates for d1vsam1:

Click to download the PDB-style file with coordinates for d1vsam1.
(The format of our PDB-style files is described here.)

Timeline for d1vsam1: