SCOPe 2.03: Domain d1vs8g2: 1vs8 G:82-176

Lineage for d1vs8g2 (1vs8 G:82-176)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
   Uniprot P02390 1-81! Uniprot P02390 82-176

8. Domain d1vs8g2: 1vs8 G:82-176 [144503]
   Other proteins in same PDB: d1vs801, d1vs811, d1vs821, d1vs831, d1vs841, d1vs8c1, d1vs8c2, d1vs8d1, d1vs8e1, d1vs8f1, d1vs8h1, d1vs8h2, d1vs8i1, d1vs8i2, d1vs8j1, d1vs8k1, d1vs8l1, d1vs8m1, d1vs8n1, d1vs8o1, d1vs8p1, d1vs8q1, d1vs8r1, d1vs8s1, d1vs8t1, d1vs8u1, d1vs8v1, d1vs8w1, d1vs8x1, d1vs8y1, d1vs8z1
   automatically matched to 2AW4 G:82-176
   complexed with mg

Details for d1vs8g2

PDB Entry: 1vs8, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 50s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d1vs8g2:

Sequence; same for both SEQRES and ATOM records:

>d1vs8g2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
ftkklqlvgvgyraavkgnvinlslgfshpvdhqlpagitaecptqteivlkgadkqvig
qvaadlrayrrpepykgkgvryadevvrtkeakkk

Timeline for d1vs8g2:

• d1vs8g2 first appeared in SCOP 1.75
  
• d1vs8g2 appears in SCOPe 2.02
  
• d1vs8g2 appears in SCOPe 2.04
  
• d1vs8g2 appears in the current release, SCOPe 2.08