Lineage for d1vs8g1 (1vs8 G:1-81)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873695Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 873696Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 873697Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 873698Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 873804Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
    Uniprot P02390 1-81! Uniprot P02390 82-176
  8. 873839Domain d1vs8g1: 1vs8 G:1-81 [144502]
    Other proteins in same PDB: d1vs801, d1vs811, d1vs821, d1vs831, d1vs841, d1vs8c1, d1vs8c2, d1vs8d1, d1vs8e1, d1vs8f1, d1vs8h1, d1vs8h2, d1vs8i1, d1vs8i2, d1vs8j1, d1vs8k1, d1vs8l1, d1vs8m1, d1vs8n1, d1vs8o1, d1vs8p1, d1vs8q1, d1vs8r1, d1vs8s1, d1vs8t1, d1vs8u1, d1vs8v1, d1vs8w1, d1vs8x1, d1vs8y1, d1vs8z1
    automatically matched to 2AW4 G:1-81
    complexed with mg

Details for d1vs8g1

PDB Entry: 1vs8 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 50s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (G:) 50S ribosomal protein L6

SCOP Domain Sequences for d1vs8g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs8g1 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
srvakapvvvpagvdvkingqvitikgkngeltrtlndavevkhadntltfgprdgyadg
waqagtarallnsmvigvteg

SCOP Domain Coordinates for d1vs8g1:

Click to download the PDB-style file with coordinates for d1vs8g1.
(The format of our PDB-style files is described here.)

Timeline for d1vs8g1: