Lineage for d1vs8c1 (1vs8 C:125-269)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1121207Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 1121370Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 1121371Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 1121381Species Escherichia coli [TaxId:562] [159027] (27 PDB entries)
    Uniprot P60422 125-269
  8. 1121396Domain d1vs8c1: 1vs8 C:125-269 [144497]
    Other proteins in same PDB: d1vs801, d1vs811, d1vs821, d1vs831, d1vs841, d1vs8c2, d1vs8d1, d1vs8e1, d1vs8f1, d1vs8g1, d1vs8g2, d1vs8h1, d1vs8h2, d1vs8i1, d1vs8i2, d1vs8j1, d1vs8k1, d1vs8l1, d1vs8m1, d1vs8n1, d1vs8o1, d1vs8p1, d1vs8q1, d1vs8r1, d1vs8s1, d1vs8t1, d1vs8u1, d1vs8v1, d1vs8w1, d1vs8x1, d1vs8y1, d1vs8z1
    automatically matched to 2AW4 C:125-269
    complexed with mg

Details for d1vs8c1

PDB Entry: 1vs8 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 50s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d1vs8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs8c1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
pgntlpmrnipvgstvhnvemkpgkggqlarsagtyvqivardgayvtlrlrsgemrkve
adcratlgevgnaehmlrvlgkagaarwrgvrptvrgtamnpvdhphgggegrnfgkhpv
tpwgvqtkgkktrsnkrtdkfivrr

SCOPe Domain Coordinates for d1vs8c1:

Click to download the PDB-style file with coordinates for d1vs8c1.
(The format of our PDB-style files is described here.)

Timeline for d1vs8c1: