Lineage for d1vs7u1 (1vs7 U:3-53)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2652110Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 2652111Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) (S)
  5. 2652112Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
    Pfam PF01165
  6. 2652113Protein Ribosomal protein S21, RpsU [161310] (1 species)
  7. 2652114Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
    Uniprot P68679 4-54
  8. 2652126Domain d1vs7u1: 1vs7 U:3-53 [144496]
    Other proteins in same PDB: d1vs7b1, d1vs7c1, d1vs7c2, d1vs7d1, d1vs7e1, d1vs7e2, d1vs7f1, d1vs7g1, d1vs7h1, d1vs7i1, d1vs7j1, d1vs7k1, d1vs7l1, d1vs7m1, d1vs7n1, d1vs7o1, d1vs7p1, d1vs7q1, d1vs7r1, d1vs7s1, d1vs7t1
    complexed with ksg, mg
    complexed with ksg, mg

Details for d1vs7u1

PDB Entry: 1vs7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d1vs7u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs7u1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

SCOPe Domain Coordinates for d1vs7u1:

Click to download the PDB-style file with coordinates for d1vs7u1.
(The format of our PDB-style files is described here.)

Timeline for d1vs7u1: