SCOP 1.75: Domain d1vs7r1: 1vs7 R:19-73

Lineage for d1vs7r1 (1vs7 R:19-73)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
   Uniprot P0A7T7 19-73

8. Domain d1vs7r1: 1vs7 R:19-73 [144493]
   Other proteins in same PDB: d1vs7b1, d1vs7c1, d1vs7c2, d1vs7d1, d1vs7e1, d1vs7e2, d1vs7f1, d1vs7g1, d1vs7h1, d1vs7i1, d1vs7j1, d1vs7k1, d1vs7l1, d1vs7m1, d1vs7n1, d1vs7o1, d1vs7p1, d1vs7q1, d1vs7s1, d1vs7t1, d1vs7u1
   automatically matched to 2AVY R:19-73
   complexed with ksg, mg

Details for d1vs7r1

PDB Entry: 1vs7, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (R:) 30S ribosomal protein S18

SCOP Domain Sequences for d1vs7r1:

Sequence; same for both SEQRES and ATOM records:

>d1vs7r1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

Timeline for d1vs7r1:

• d1vs7r1 is new in SCOP 1.75
  
• d1vs7r1 appears in SCOPe 2.01
  
• d1vs7r1 appears in the current release, SCOPe 2.08