Lineage for d1vs7l1 (1vs7 L:1-123)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 799967Protein Ribosomal protein S12 [50302] (2 species)
  7. 799968Species Escherichia coli [TaxId:562] [159087] (25 PDB entries)
    Uniprot P0A7S3 1-123
  8. 799976Domain d1vs7l1: 1vs7 L:1-123 [144487]
    Other proteins in same PDB: d1vs7b1, d1vs7c1, d1vs7c2, d1vs7d1, d1vs7e1, d1vs7e2, d1vs7f1, d1vs7g1, d1vs7h1, d1vs7i1, d1vs7j1, d1vs7k1, d1vs7m1, d1vs7n1, d1vs7o1, d1vs7p1, d1vs7q1, d1vs7r1, d1vs7s1, d1vs7t1, d1vs7u1
    automatically matched to 2AVY L:1-123
    complexed with ksg, mg

Details for d1vs7l1

PDB Entry: 1vs7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (L:) 30S ribosomal protein S12

SCOP Domain Sequences for d1vs7l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs7l1 b.40.4.5 (L:1-123) Ribosomal protein S12 {Escherichia coli [TaxId: 562]}
atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
pka

SCOP Domain Coordinates for d1vs7l1:

Click to download the PDB-style file with coordinates for d1vs7l1.
(The format of our PDB-style files is described here.)

Timeline for d1vs7l1: