Class a: All alpha proteins [46456] (284 folds) |
Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) |
Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
Protein Ribosomal protein S7 [47975] (4 species) |
Species Escherichia coli [TaxId:562] [158599] (24 PDB entries) Uniprot P02359 2-151 |
Domain d1vs7g1: 1vs7 G:2-151 [144483] Other proteins in same PDB: d1vs7b1, d1vs7c1, d1vs7c2, d1vs7d1, d1vs7e1, d1vs7e2, d1vs7f1, d1vs7h1, d1vs7i1, d1vs7j1, d1vs7k1, d1vs7l1, d1vs7m1, d1vs7n1, d1vs7o1, d1vs7p1, d1vs7q1, d1vs7r1, d1vs7s1, d1vs7t1, d1vs7u1 automatically matched to 2AVY G:2-151 complexed with ksg, mg |
PDB Entry: 1vs7 (more details), 3.46 Å
SCOPe Domain Sequences for d1vs7g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vs7g1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]} rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan elsdaaenkgtavkkredvhrmaeankafa
Timeline for d1vs7g1: