Lineage for d1vs5g1 (1vs5 G:2-151)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1092301Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1092302Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1092303Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1092304Protein Ribosomal protein S7 [47975] (4 species)
  7. 1092307Species Escherichia coli [TaxId:562] [158599] (24 PDB entries)
    Uniprot P02359 2-151
  8. 1092316Domain d1vs5g1: 1vs5 G:2-151 [144442]
    Other proteins in same PDB: d1vs5b1, d1vs5c1, d1vs5c2, d1vs5d1, d1vs5e1, d1vs5e2, d1vs5f1, d1vs5h1, d1vs5i1, d1vs5j1, d1vs5k1, d1vs5l1, d1vs5m1, d1vs5n1, d1vs5o1, d1vs5p1, d1vs5q1, d1vs5r1, d1vs5s1, d1vs5t1, d1vs5u1
    automatically matched to 2AVY G:2-151
    complexed with ksg, mg

Details for d1vs5g1

PDB Entry: 1vs5 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1vs5g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs5g1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]}
rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf
evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan
elsdaaenkgtavkkredvhrmaeankafa

SCOPe Domain Coordinates for d1vs5g1:

Click to download the PDB-style file with coordinates for d1vs5g1.
(The format of our PDB-style files is described here.)

Timeline for d1vs5g1: