Lineage for d1vs5e2 (1vs5 E:9-77)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553728Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2553729Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2553810Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
    automatically mapped to Pfam PF00333
  6. 2553811Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
    lacks the N-terminal helix
  7. 2553814Species Escherichia coli [TaxId:562] [160202] (24 PDB entries)
    Uniprot P0A7W1 9-77
  8. 2553825Domain d1vs5e2: 1vs5 E:9-77 [144440]
    Other proteins in same PDB: d1vs5b1, d1vs5c1, d1vs5c2, d1vs5d1, d1vs5e1, d1vs5f1, d1vs5g1, d1vs5h1, d1vs5i1, d1vs5j1, d1vs5k1, d1vs5l1, d1vs5m1, d1vs5n1, d1vs5o1, d1vs5p1, d1vs5q1, d1vs5r1, d1vs5s1, d1vs5t1, d1vs5u1
    complexed with ksg, mg
    complexed with ksg, mg

Details for d1vs5e2

PDB Entry: 1vs5 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1vs5e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs5e2 d.50.1.2 (E:9-77) Ribosomal S5 protein, N-terminal domain {Escherichia coli [TaxId: 562]}
elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
nminvalnn

SCOPe Domain Coordinates for d1vs5e2:

Click to download the PDB-style file with coordinates for d1vs5e2.
(The format of our PDB-style files is described here.)

Timeline for d1vs5e2: