Lineage for d1vqpg1 (1vqp G:12-73)

  1. Root: SCOPe 2.01
  2. 1072259Class j: Peptides [58231] (120 folds)
  3. 1073736Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 1073737Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 1073738Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 1073739Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 1073740Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 1073743Domain d1vqpg1: 1vqp G:12-73 [144432]
    Other proteins in same PDB: d1vqp11, d1vqp21, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
    automatically matched to 1VQ4 G:12-73
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqpg1

PDB Entry: 1vqp (more details), 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (G:) Acidic ribosomal protein P0 homolog

SCOPe Domain Sequences for d1vqpg1:

Sequence, based on SEQRES records: (download)

>d1vqpg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1vqpg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d1vqpg1:

Click to download the PDB-style file with coordinates for d1vqpg1.
(The format of our PDB-style files is described here.)

Timeline for d1vqpg1: