Lineage for d1u3he_ (1u3h E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757747Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1757852Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (21 PDB entries)
  8. 1757864Domain d1u3he_: 1u3h E: [144385]
    Other proteins in same PDB: d1u3hc1, d1u3hc2, d1u3hd1, d1u3hd2, d1u3hg1, d1u3hg2, d1u3hh1, d1u3hh2
    automated match to d1u3ha1

Details for d1u3he_

PDB Entry: 1u3h (more details), 2.42 Å

PDB Description: crystal structure of mouse tcr 172.10 complexed with mhc class ii i-au molecule at 2.4 a
PDB Compounds: (E:) T-cell receptor alpha-chain

SCOPe Domain Sequences for d1u3he_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3he_ b.1.1.1 (E:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
qvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsdkkedgrf
tiffnkrekklslhiadsqpgdsatyfcaasansgtyqrfgtgtklqvvp

SCOPe Domain Coordinates for d1u3he_:

Click to download the PDB-style file with coordinates for d1u3he_.
(The format of our PDB-style files is described here.)

Timeline for d1u3he_: