![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries) |
![]() | Domain d1u3hb1: 1u3h B:3-117 [144384] Other proteins in same PDB: d1u3hc1, d1u3hc2, d1u3hc3, d1u3hd1, d1u3hd2, d1u3hg1, d1u3hg2, d1u3hg3, d1u3hh1, d1u3hh2 |
PDB Entry: 1u3h (more details), 2.42 Å
SCOPe Domain Sequences for d1u3hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3hb1 b.1.1.1 (B:3-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} avtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghglrliyysygagstekgdipd gykasrpsqenfsltlesatpsqtsvyfcasgdagggyeqyfgpgtrltvl
Timeline for d1u3hb1: