SCOPe 2.05: Domain d1tu2b2: 1tu2 B:170-235

Lineage for d1tu2b2 (1tu2 B:170-235)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)

6. Protein Cytochrome f, small domain [51257] (5 species)

7. Species Nostoc sp. PCC 7120 [TaxId:103690] [159321] (1 PDB entry)
   Uniprot Q93SW9 214-279

8. Domain d1tu2b2: 1tu2 B:170-235 [144381]
   Other proteins in same PDB: d1tu2a1, d1tu2b1
   complexed with cu, hec

Details for d1tu2b2

PDB Entry: 1tu2

PDB Description: the complex of nostoc cytochrome f and plastocyanin determin with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures

PDB Compounds: (B:) Apocytochrome f

SCOPe Domain Sequences for d1tu2b2:

Sequence; same for both SEQRES and ATOM records:

>d1tu2b2 b.84.2.2 (B:170-235) Cytochrome f, small domain {Nostoc sp. PCC 7120 [TaxId: 103690]}
nlysaaatgtiskiakqegedgsvkylvdiktesgevvsdtipagpelivsegqavtagd
altnnp

Timeline for d1tu2b2:

• d1tu2b2 first appeared in SCOP 1.75
  
• d1tu2b2 appears in SCOPe 2.04
  
• d1tu2b2 appears in SCOPe 2.06
  
• d1tu2b2 appears in the current release, SCOPe 2.08