SCOPe 2.04: Domain d1tu2b1: 1tu2 B:1-169,B:236-254

Lineage for d1tu2b1 (1tu2 B:1-169,B:236-254)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family)

5. Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)

6. Protein Cytochrome f, large domain [49443] (5 species)
   this domain is interrupted by a small domain which is barrel-sandwich hybrid fold

7. Species Nostoc sp. PCC 7120 [TaxId:103690] [158930] (1 PDB entry)
   Uniprot Q93SW9 45-213,280-298

8. Domain d1tu2b1: 1tu2 B:1-169,B:236-254 [144380]
   Other proteins in same PDB: d1tu2a1, d1tu2b2
   complexed with cu, hec

Details for d1tu2b1

PDB Entry: 1tu2

PDB Description: the complex of nostoc cytochrome f and plastocyanin determin with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures

PDB Compounds: (B:) Apocytochrome f

SCOPe Domain Sequences for d1tu2b1:

Sequence; same for both SEQRES and ATOM records:

>d1tu2b1 b.2.6.1 (B:1-169,B:236-254) Cytochrome f, large domain {Nostoc sp. PCC 7120 [TaxId: 103690]}
ypfwaqqtypetpreptgrivcanchlaakptevevpqsvlpdtvfkavvkipydtsvqq
vgadgskvglnvgavlmlpegfkiapedripeelkeeigdvyfqpygedkdnivivgplp
geqyqeivfpvlspnpandknihfgkysvhvggnrgrgqvyptgeksnnXnvggfgqlda
eivlqdanr

Timeline for d1tu2b1:

• d1tu2b1 first appeared in SCOP 1.75
  
• d1tu2b1 appears in SCOPe 2.03
  
• d1tu2b1 appears in SCOPe 2.05
  
• d1tu2b1 appears in the current release, SCOPe 2.08