SCOPe 2.03: Domain d1sqxk_: 1sqx K:

Lineage for d1sqxk_ (1sqx K:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family)
   automatically mapped to Pfam PF08997

5. Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins)

6. Protein automated matches [190648] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187726] (3 PDB entries)

8. Domain d1sqxk_: 1sqx K: [144379]
   Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxe1, d1sqxe2, d1sqxf_, d1sqxg_, d1sqxh_, d1sqxi_, d1sqxj_
   automated match to d1sqqk1
   complexed with fes, hem, sma, uq2

Details for d1sqxk_

PDB Entry: 1sqx, 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a

PDB Compounds: (K:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOPe Domain Sequences for d1sqxk_:

Sequence; same for both SEQRES and ATOM records:

>d1sqxk_ f.23.15.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfk

Timeline for d1sqxk_:

• d1sqxk_ first appeared in SCOP 1.75, called d1sqxk1
  
• d1sqxk_ appears in SCOPe 2.02
  
• d1sqxk_ appears in SCOPe 2.04
  
• d1sqxk_ appears in the current release, SCOPe 2.08