![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) ![]() automatically mapped to Pfam PF08997 |
![]() | Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins) |
![]() | Protein automated matches [190648] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187726] (5 PDB entries) |
![]() | Domain d1sqxk_: 1sqx K: [144379] Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxe1, d1sqxe2, d1sqxf_, d1sqxg_, d1sqxh_, d1sqxi_, d1sqxj_ automated match to d1sqqk1 complexed with fes, hec, sma, uq2 |
PDB Entry: 1sqx (more details), 2.6 Å
SCOPe Domain Sequences for d1sqxk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqxk_ f.23.15.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]} mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfk
Timeline for d1sqxk_: