Lineage for d1sqxk_ (1sqx K:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578980Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) (S)
    automatically mapped to Pfam PF08997
  5. 2578981Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins)
  6. 2578997Protein automated matches [190648] (1 species)
    not a true protein
  7. 2578998Species Cow (Bos taurus) [TaxId:9913] [187726] (5 PDB entries)
  8. 2579000Domain d1sqxk_: 1sqx K: [144379]
    Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxe1, d1sqxe2, d1sqxf_, d1sqxg_, d1sqxh_, d1sqxi_, d1sqxj_
    automated match to d1sqqk1
    complexed with fes, hem, sma, uq2

Details for d1sqxk_

PDB Entry: 1sqx (more details), 2.6 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Stigmatellin A
PDB Compounds: (K:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOPe Domain Sequences for d1sqxk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqxk_ f.23.15.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfk

SCOPe Domain Coordinates for d1sqxk_:

Click to download the PDB-style file with coordinates for d1sqxk_.
(The format of our PDB-style files is described here.)

Timeline for d1sqxk_: