Lineage for d1sqvk_ (1sqv K:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238620Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) (S)
  5. 1238621Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins)
  6. 1238637Protein automated matches [190648] (1 species)
    not a true protein
  7. 1238638Species Cow (Bos taurus) [TaxId:9913] [187726] (3 PDB entries)
  8. 1238641Domain d1sqvk_: 1sqv K: [144378]
    Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqvf_, d1sqvg_, d1sqvh_, d1sqvi1, d1sqvj_
    automated match to d1sqqk1
    complexed with fes, hem, uhd, uq2

Details for d1sqvk_

PDB Entry: 1sqv (more details), 2.85 Å

PDB Description: crystal structure analysis of bovine bc1 with uhdbt
PDB Compounds: (K:) Ubiquinol-cytochrome c reductase complex 6.4 kDa protein

SCOPe Domain Sequences for d1sqvk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqvk_ f.23.15.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingk

SCOPe Domain Coordinates for d1sqvk_:

Click to download the PDB-style file with coordinates for d1sqvk_.
(The format of our PDB-style files is described here.)

Timeline for d1sqvk_: