Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) |
Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins) |
Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species) the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located |
Species Cow (Bos taurus) [TaxId:9913] [81515] (12 PDB entries) Uniprot P07552 |
Domain d1sqqk1: 1sqq K:1-54 [144377] Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqi1, d1sqqj1 complexed with fes, hem, ost, uq2 |
PDB Entry: 1sqq (more details), 3 Å
SCOPe Domain Sequences for d1sqqk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqqk1 f.23.15.1 (K:1-54) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfkk
Timeline for d1sqqk1: