Lineage for d1sqqk1 (1sqq K:1-54)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887604Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) (S)
  5. 887605Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (1 protein)
  6. 887606Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
    the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located
  7. 887607Species Cow (Bos taurus) [TaxId:9913] [81515] (15 PDB entries)
    Uniprot P07552
  8. 887618Domain d1sqqk1: 1sqq K:1-54 [144377]
    Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqi1, d1sqqj1
    complexed with fes, hem, ost, uq2

Details for d1sqqk1

PDB Entry: 1sqq (more details), 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
PDB Compounds: (K:) Ubiquinol-cytochrome c reductase complex 6.4 kDa protein

SCOP Domain Sequences for d1sqqk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqk1 f.23.15.1 (K:1-54) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfkk

SCOP Domain Coordinates for d1sqqk1:

Click to download the PDB-style file with coordinates for d1sqqk1.
(The format of our PDB-style files is described here.)

Timeline for d1sqqk1: