Lineage for d1sqpk1 (1sqp K:1-53)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887604Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) (S)
  5. 887605Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (1 protein)
  6. 887606Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
    the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located
  7. 887607Species Cow (Bos taurus) [TaxId:9913] [81515] (15 PDB entries)
    Uniprot P07552
  8. 887617Domain d1sqpk1: 1sqp K:1-53 [144376]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpf1, d1sqpg1, d1sqph1, d1sqpi1, d1sqpj1
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpk1

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol
PDB Compounds: (K:) Ubiquinol-cytochrome c reductase complex 6.4 kDa protein

SCOP Domain Sequences for d1sqpk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqpk1 f.23.15.1 (K:1-53) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaglwgavgavglvwatdwrlildwvpyingkfk

SCOP Domain Coordinates for d1sqpk1:

Click to download the PDB-style file with coordinates for d1sqpk1.
(The format of our PDB-style files is described here.)

Timeline for d1sqpk1: