Lineage for d1sqpf1 (1sqp F:6-110)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1458053Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1458054Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 1458055Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1458056Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 1458067Species Cow (Bos taurus) [TaxId:9913] [81519] (14 PDB entries)
    Uniprot P00129
  8. 1458078Domain d1sqpf1: 1sqp F:6-110 [144375]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpe1, d1sqpe2, d1sqpg_, d1sqph_, d1sqpi_, d1sqpj_, d1sqpk1
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpf1

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol
PDB Compounds: (F:) sub6

SCOPe Domain Sequences for d1sqpf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqpf1 f.27.1.1 (F:6-110) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vsassrwlekirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

SCOPe Domain Coordinates for d1sqpf1:

Click to download the PDB-style file with coordinates for d1sqpf1.
(The format of our PDB-style files is described here.)

Timeline for d1sqpf1: