SCOP 1.75: Domain d1sqpf1: 1sqp F:6-110

Lineage for d1sqpf1 (1sqp F:6-110)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81519] (18 PDB entries)
   Uniprot P00129

8. Domain d1sqpf1: 1sqp F:6-110 [144375]
   Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpg1, d1sqph1, d1sqpi1, d1sqpj1, d1sqpk1
   complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpf1

PDB Entry: 1sqp, 2.7 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Myxothiazol

PDB Compounds: (F:) sub6

SCOP Domain Sequences for d1sqpf1:

Sequence; same for both SEQRES and ATOM records:

>d1sqpf1 f.27.1.1 (F:6-110) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vsassrwlekirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

Timeline for d1sqpf1:

• d1sqpf1 is new in SCOP 1.75
  
• d1sqpf1 appears in SCOPe 2.01
  
• d1sqpf1 appears in the current release, SCOPe 2.07