Lineage for d1sqpf1 (1sqp F:6-110)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 888076Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 888077Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
  5. 888078Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 888079Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 888095Species Cow (Bos taurus) [TaxId:9913] [81519] (18 PDB entries)
    Uniprot P00129
  8. 888111Domain d1sqpf1: 1sqp F:6-110 [144375]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpg1, d1sqph1, d1sqpi1, d1sqpj1, d1sqpk1
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpf1

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol
PDB Compounds: (F:) sub6

SCOP Domain Sequences for d1sqpf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqpf1 f.27.1.1 (F:6-110) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vsassrwlekirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

SCOP Domain Coordinates for d1sqpf1:

Click to download the PDB-style file with coordinates for d1sqpf1.
(The format of our PDB-style files is described here.)

Timeline for d1sqpf1: