Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (1 family) |
Family d.37.1.1: CBS-domain pair [54632] (20 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein Hypothetical protein MTH1622 [102897] (1 species) |
Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [102898] (1 PDB entry) |
Domain d1pbja3: 1pbj A:2-121 [144366] structural genomics complexed with mg |
PDB Entry: 1pbj (more details), 1.4 Å
SCOP Domain Sequences for d1pbja3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} rvedvmvtdvdtiditasledvlrnyvenakgssvvvkegvrvgivttwdvleaiaegdd laevkvwevmerdlvtispratikeaaekmvknvvwrllveeddeiigvisatdilrakm
Timeline for d1pbja3: